PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009117997.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 266aa    MW: 30558.2 Da    PI: 9.3627
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009117997.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.92.4e-2774155286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k++++++   +s +++y++++e
  XP_009117997.1  74 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGN---RSAKMSYYKEIE 155
                     ********************************************************************95...566899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-464135IPR009057Homeodomain-like
PROSITE profilePS500907.97966130IPR017877Myb-like domain
SMARTSM007170.009670132IPR001005SANT/Myb domain
CDDcd122035.41E-2872137No hitNo description
PfamPF138371.7E-2073157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MFVSDKPRPI DFYKDDNTTT ARDNMIIDVT TNAPGRDLHP HHHHHHLQPQ QILLGESSGE  60
DHEVKAPKKR AETWVQDETR SLIMFRRGMD GLFNTSKSNK HLWEQISAKM REKGFDRSPT  120
MCTDKWRNLL KEFKKAKHHD RGNRSAKMSY YKEIEEILRE RSKKVTATGQ YSKSSNATPT  180
AKVDSFMQFT DKGFDDPSIS FGSVEANGRP ALNLERRLDH DGHPLAIATV DAVAANGVPP  240
WNWRETPGNG KWGFSWSAFW WEGHNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A7e-5668153186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.129580.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009117997.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X4
SwissprotQ9FX531e-140TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A078GN890.0A0A078GN89_BRANA; BnaA09g46250D protein
STRINGBra026903.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.31e-143Trihelix family protein